PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_209.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 304aa    MW: 34125.8 Da    PI: 7.1718
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_209.8genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.68.6e-11172215548
                                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                                  kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  evm.model.supercontig_209.8 172 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 215
                                  8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.8E-14168232IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.622170222IPR004827Basic-leucine zipper domain
PfamPF001704.4E-9172216IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.7E-11172226No hitNo description
Gene3DG3DSA:1.20.5.1703.7E-13172223No hitNo description
CDDcd147032.08E-23173223No hitNo description
PROSITE patternPS000360175190IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MAQLPPKIPN MTQNWPEQKL GSMAATNSQN LSWVDEFLDF SAARRGTHRR SISDSIAFLE  60
LDQCPSSQNH NHNPDQSNGG FDDEHFMSMF SDDRLPNAVA PILSSSNPST PSDHNSINDD  120
KDAPSSDHPP KHHNQFKNEA EEVQSQCTTA TDPNPSINAP ANVSSDRIVD PKRVKRILAN  180
RQSAQRSRVR KLQYISELER SVTSLQAEVS VLSPRVAFLD HQRLLLNVDN SALKQRIAAL  240
AQDKIFKDAH QEALKREIER LRQVYQQRKL NKMESNSGAP PPADHHVKPS TEKEQQQQQL  300
LNV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006469052.11e-129PREDICTED: basic leucine zipper 61
SwissprotQ9M2K41e-122BZP61_ARATH; Basic leucine zipper 61
TrEMBLV4THT81e-126V4THT8_9R
STRINGAT3G58120.11e-119(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-123bZIP family protein